General Information

  • ID:  hor001861
  • Uniprot ID:  P01180
  • Protein name:  Proline-rich peptide
  • Gene name:  AVP
  • Organism:  Bos taurus (Bovine)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  AGAPEPAEPAQPGVY
  • Length:  15
  • Propeptide:  MPDATLPACFLSLLAFTSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGVGFPRRVRANDRSNATLLDGPSGALLLRLVQLAGAPEPAEPAQPGVY
  • Signal peptide:  MPDATLPACFLSLLAFTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Increased colony-forming cell (CFC) proliferation in rat bone marrow (BM) cells in vivo
  • Mechanism:  Fetal neurophysin is the major neurophysin present in the neurohypophysis of 7 to 9 month fetuses and its sequence appears to be identical with that of the adult.
  • Cross BBB:  NA
  • Target:  AVPR2, AVPR1A
  • Target Unid:  P48044, F6PV87
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01180-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001861_AF2.pdbhor001861_ESM.pdb

Physical Information

Mass: 170347 Formula: C65H96N16O22
Absent amino acids: CDFHIKLMNRSTW Common amino acids: AP
pI: 3.61 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: -50.67 Boman Index: -614
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 46
Instability Index: 8727.33 Extinction Coefficient cystines: 1490
Absorbance 280nm: 106.43

Literature

  • PubMed ID:  19177842
  • Title:  Hypothalamic Proline-Rich Polypeptide Enhances Bone Marrow Colony-Forming Cell Proliferation and Stromal Progenitor Cell Differentiation